Keep my session open?
Ending In 
The session is expired
A sua sessão expirou. Para sua segurança, fechámos a sua sessão.
Gostaria de reiniciar sessão?

Anti-FAM127A Mouse Monoclonal Antibody

Fornecedor: Abnova
Mouse monoclonal antibody raised against a full-length recombinant FAM127A.

Type: Primary
Antigen: FAM127A
Clonality: Monoclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype:
Reactivity: Human




 

ENCOMENDA

Expandir tudo / Esconder tudo
Tamanho Und. Referência VWR Quantidade
Up to 5 Clones 1 ABNOH00008933-M
Gerar códigos de barras Barcode Label Format: 
Criar página do catálogo em PDF

ESPECIFICAÇÕES

Antigen symbol FAM127A
Antigen name Family with sequence similarity 127, member A
Reactivity Human
Conjugation Unconjugated
Clonality Monoclonal
Antibody type Primary
Host Mouse
Western blot Yes
ELISA Yes
Antigen synonyms MAR8C, CXX1, Mar8, MART8C, Mart8
Amino acid number 1 to 209
Gene ID 8933
Formato Liquid
Cross adsorption No
Immunogen FAM127A (NP_003919.1, 1 a.a. ~ 209 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence MGGGRGLLGRETLGPGGGCSGEGPLCYWPPPGSPPAPSLRASLPLEPPRCPLRSCSLPRSACLCSRNSAPGSCCRPWASLWSEPPPSPSSQPAPPMYIWTLSCAPAASWAPVTHWTDHPLPPLPSPLLPTRLPDDYIILPTDLRCHSHRHPSHPTDRLLLLVIWTHLGGIWAGHSPWTVIQTAGRPPRDLSPSARPISSPPPETSCVLA
Detalhes

Selecione o artigo para o qual procura o Certificado

Indique o número do lote. Este campo é obrigatório.

Inserir detalhes do certificado

Número de Lote:

Choose from recent batch/lot numbers:

Ou
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Descrição Código de Artigo Disponibilidade Unidade O seu preço Preço por Qtd