Keep my session open?
Ending In 
The session is expired
A sua sessão expirou. Para sua segurança, fechámos a sua sessão.
Gostaria de reiniciar sessão?

Anti-SPOP Mouse Polyclonal Antibody

Fornecedor: US Biological
Recommended dilution: Immunofluorescence: 10 μg/ml

Type: Primary
Antigen: SPOP (speckle-type POZ protein)
Clonality: polyclonal
Clone:
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG
Reactivity: Human



 

ENCOMENDA

Expandir tudo / Esconder tudo
Tamanho Und. Referência VWR Quantidade
50 µg 50 µG USBI133793
Gerar códigos de barras Barcode Label Format: 
Criar página do catálogo em PDF

ESPECIFICAÇÕES

Antigen symbol SPOP
Antigen name speckle-type POZ Protein
Reactivity Human
Conjugation Unconjugated
Clonality Polyclonal
Antibody type Primary
Host Mouse
Isotype IgG
Western blot Yes
ImmunoFluorescence Yes
Amino acid number 1 to 374
Purification purified by Protein A chromatography
Sequence MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS
Form liquid
Storage buffer PBS, pH 7,2.
Temperatura de armazenamento Cool
Shipping temperature Ice
Detalhes

Selecione o artigo para o qual procura o Certificado

Indique o número do lote. Este campo é obrigatório.

Inserir detalhes do certificado

Número de Lote:

Choose from recent batch/lot numbers:

Ou
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Descrição Código de Artigo Disponibilidade Unidade O seu preço Preço por Qtd
 

Um novo aspeto e um compromisso renovado

Desenvolvido com base nas funcionalidades e recursos que já conhece, e otimizado com a inovação da Avantor®. A nossa nova marca simboliza agilidade, bem como a nossa capacidade de nos adaptarmos às necessidades do cliente.

SAIBA MAIS COMECE A FAZER COMPRAS