Keep my session open?
Ending In 
The session is expired
A sua sessão expirou. Para sua segurança, fechámos a sua sessão.
Gostaria de reiniciar sessão?

Anti-SPG21 Mouse Monoclonal Antibody [clone: 2B11]

Fornecedor: US Biological
Type: Primary
Antigen: SPG21 (spastic paraplegia 21 (autosomal recessive, Mast syndrome))
Clonality: monoclonal
Clone: 2B11
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a Kappa
Reactivity: Human



Faça Login na página para visualizar o seu preço e disponibilidade dos artigos.
  Lembrar-me neste dispositivo
 

ENCOMENDA

Expandir tudo / Esconder tudo
Tamanho Und. Referência VWR Quantidade
100 µg 100 µG USBI133761
Gerar códigos de barras Barcode Label Format: 
Criar página do catálogo em PDF

ESPECIFICAÇÕES

Antigen symbol SPG21
Antigen name spastic paraplegia 21 (autosomal recessive, Mast syndrome)
Reactivity Human
Conjugation Unconjugated
Clonality Monoclonal
Antibody type Primary
Clone 2B11
Host Mouse
Isotype IgG2a kappa
ELISA Yes
Amino acid number 211 to 307
Purification purified by Protein A chromatography
Sequence PHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGSLGISQE
Form liquid
Storage buffer PBS, pH 7,2.
Temperatura de armazenamento Cool
Shipping temperature Ice
Detalhes

Selecione o artigo para o qual procura o Certificado

Indique o número do lote. Este campo é obrigatório.

Inserir detalhes do certificado

Número de Lote:

Choose from recent batch/lot numbers:

Ou
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Descrição Código de Artigo Disponibilidade Unidade O seu preço Preço por Qtd