Keep my session open?
Ending In 
The session is expired
A sua sessão expirou. Para sua segurança, fechámos a sua sessão.
Gostaria de reiniciar sessão?

Anti-SP3 Mouse Monoclonal Antibody [clone: 3H7]

Fornecedor: US Biological
Recommended dilution: Immunofluorescence: 10 μg/ml

Type: Primary
Antigen: SP3 (Sp3 transcription factor)
Clonality: monoclonal
Clone: 3H7
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG2b Kappa
Reactivity: Human



 

ENCOMENDA

Expandir tudo / Esconder tudo
Tamanho Und. Referência VWR Quantidade
100 µg 100 µG USBI133736
Gerar códigos de barras Barcode Label Format: 
Criar página do catálogo em PDF

ESPECIFICAÇÕES

Antigen symbol SP3
Antigen name Sp3 transcription factor
Reactivity Human
Conjugation Unconjugated
Clonality Monoclonal
Antibody type Primary
Clone 3H7
Host Mouse
Isotype IgG2b kappa
Western blot Yes
ELISA Yes
ImmunoFluorescence Yes
Amino acid number 516 to 616
Purification purified by Protein A chromatography
Sequence GQLPNLQTVTVNSIDSAGIQLHPGENADSPADIRIKEEEPDPEEWQLSGDSTLNTNDLTHLRVQVVDEEGDQQHQEGKRLRRVACTCPNCKEGGGRGTNL*
Form liquid
Storage buffer PBS, pH 7,2.
Temperatura de armazenamento Cool
Shipping temperature Ice
Detalhes

Selecione o artigo para o qual procura o Certificado

Indique o número do lote. Este campo é obrigatório.

Inserir detalhes do certificado

Número de Lote:

Choose from recent batch/lot numbers:

Ou
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Descrição Código de Artigo Disponibilidade Unidade O seu preço Preço por Qtd
 

Um novo aspeto e um compromisso renovado

Desenvolvido com base nas funcionalidades e recursos que já conhece, e otimizado com a inovação da Avantor®. A nossa nova marca simboliza agilidade, bem como a nossa capacidade de nos adaptarmos às necessidades do cliente.

SAIBA MAIS COMECE A FAZER COMPRAS