Keep my session open?
Ending In 
The session is expired
A sua sessão expirou. Para sua segurança, fechámos a sua sessão.
Gostaria de reiniciar sessão?

Anti-SP1 Mouse Monoclonal Antibody [clone: 1A5]

Fornecedor: US Biological
Recommended dilution: Immunofluorescence: 10 μg/ml; Immunochemistry: 1 μg/ml

Type: Primary
Antigen: SP1 (Sp1 transcription factor)
Clonality: monoclonal
Clone: 1A5
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG1
Reactivity: Human, Mouse



Faça Login na página para visualizar o seu preço e disponibilidade dos artigos.
  Lembrar-me neste dispositivo
 

ENCOMENDA

Expandir tudo / Esconder tudo
Tamanho Und. Referência VWR Quantidade
100 µg 100 µG USBI133731
Gerar códigos de barras Barcode Label Format: 
Criar página do catálogo em PDF

ESPECIFICAÇÕES

Antigen symbol SP1
Antigen name Sp1 transcription factor
Reactivity Mouse, Human
Conjugation Unconjugated
Clonality Monoclonal
Antibody type Primary
Clone 1A5
Host Mouse
Isotype IgG1
Western blot Yes
ELISA Yes
ImmunoFluorescence Yes
Amino acid number 89 to 199
Purification purified by Protein A chromatography
Sequence GTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQ*
Form liquid
Storage buffer PBS, pH 7,2.
Temperatura de armazenamento Cool
Shipping temperature Ice
Detalhes

Selecione o artigo para o qual procura o Certificado

Indique o número do lote. Este campo é obrigatório.

Inserir detalhes do certificado

Número de Lote:

Choose from recent batch/lot numbers:

Ou
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Descrição Código de Artigo Disponibilidade Unidade O seu preço Preço por Qtd