Keep my session open?
Ending In 
The session is expired
A sua sessão expirou. Para sua segurança, fechámos a sua sessão.
Gostaria de reiniciar sessão?

Anti-ACTR1A Mouse Monoclonal Antibody [clone: 3E5]

Fornecedor: Abnova
Type: Primary
Antigen: ACTR1A
Clonality: Monoclonal
Clone: 3E5
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a kappa
Reactivity: Human



 

ENCOMENDA

Expandir tudo / Esconder tudo
Tamanho Und. Referência VWR Quantidade
100 µg 100 µg ABNOH00010121-M08
Gerar códigos de barras Barcode Label Format: 
Criar página do catálogo em PDF

ESPECIFICAÇÕES

Antigen symbol ACTR1A
Antigen name ARP1 Actin-related Protein 1 Homolog A, Centractin alpha
Reactivity Human
Conjugation Unconjugated
Clonality Monoclonal
Antibody type Primary
Clone 3E5
Host Mouse
Isotype IgG2a kappa
ELISA Yes
Antigen synonyms ARP1, ARP1 actin-related protein 1 homolog A, centractin alpha (yeast), actin-RPV, centractin alpha, ARP1, yeast homolog A, centrosome-associated actin homolog, ARP1 (actin-related protein 1, yeast) homolog A (centractin alpha), CTRN1, FLJ52695, FLJ52800, FLJ55002, ARP1 actin-related protein 1 homolog A, centractin alpha
Gene ID 10121
Cross adsorption non
Immunogen ACTR1A (NP_005727, 279 a.a. ~ 375 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence LVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKT
Form Liquid
Storage buffer In 1x PBS, pH 7,4
Temperatura de armazenamento Store at – 20 °C or lower. Aliquot to avoid repeated freezing and thawing.
Shipping temperature Ice
Detalhes

Selecione o artigo para o qual procura o Certificado

Indique o número do lote. Este campo é obrigatório.

Inserir detalhes do certificado

Número de Lote:

Choose from recent batch/lot numbers:

Ou
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Descrição Código de Artigo Disponibilidade Unidade O seu preço Preço por Qtd
 

Um novo aspeto e um compromisso renovado

Desenvolvido com base nas funcionalidades e recursos que já conhece, e otimizado com a inovação da Avantor®. A nossa nova marca simboliza agilidade, bem como a nossa capacidade de nos adaptarmos às necessidades do cliente.

SAIBA MAIS COMECE A FAZER COMPRAS